PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c26_13600V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 380aa    MW: 42046.1 Da    PI: 6.8565
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c26_13600V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-1598145148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+ Ed  l  ++k +G g+W++ +++ g+ R++k+c++rw++yl
  Pp3c26_13600V3.3.p  98 KGPWTEAEDTTLSAYIKAHGEGNWRLLPKCAGLSRCGKSCRLRWLNYL 145
                         79********************************************97 PP

2Myb_DNA-binding50.93.7e-16151196148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+++ +E++l+v ++++lG++ W++Ia +++ gRt++++k++w+++l
  Pp3c26_13600V3.3.p 151 KGKFSWDEEDLIVTLHALLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 196
                         79********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.43293145IPR017930Myb domain
SuperFamilySSF466891.28E-2896192IPR009057Homeodomain-like
SMARTSM007171.5E-1297147IPR001005SANT/Myb domain
PfamPF002498.4E-1498145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2199152IPR009057Homeodomain-like
CDDcd001673.97E-10100145No hitNo description
PROSITE profilePS5129425.915146200IPR017930Myb domain
SMARTSM007173.3E-15150198IPR001005SANT/Myb domain
PfamPF002496.0E-15151196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-24153200IPR009057Homeodomain-like
CDDcd001671.65E-11153196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
RDITVHKVAV EKLLISCTVS TITECFHTEV AWRYIAFYTY MPPATKGAEI GKPGSPQEFN  60
RHNRSCAALP TVVGGAAAAG SSNMGRSQCS KGEGGIYKGP WTEAEDTTLS AYIKAHGEGN  120
WRLLPKCAGL SRCGKSCRLR WLNYLRPGLK KGKFSWDEED LIVTLHALLG NRWSLIAGRI  180
PGRTDNEIKN YWNTHLSRKL RNKGIDPCDH KVGQLTLNSK YTVDRSNSEL YAGEFIHQQP  240
TTSAEKCTTT SSPAYSKHHS PADDYEHLAL PPVKRIPPVQ GKTISSPNLS YPTYSISDGS  300
NSSGEDEYLC PYGQLCCMDW ISASDNHVLE CPPDRSHHYS VEQQNPVFNA DMSTLSISDF  360
DCLDFDIKEF QDDAANSDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25962005108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S6_416V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-59myb domain protein 4